PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P03490_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 204aa    MW: 22954.6 Da    PI: 8.8954
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P03490_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1551.7e-17132183556
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                            +r +r +kNRe+A rsR+RK+a+i eLe +v+ L +eN+aL+ eleel+ +v
  GSMUA_Achr2P03490_001 132 RRKKRIIKNRESAARSRARKQAYINELELEVARLLNENHALRRELEELRMTV 183
                            7999********************************************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000416.6E-5127143IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1706.5E-15127183No hitNo description
SMARTSM003382.7E-14128192IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.817130180IPR004827Basic-leucine zipper domain
CDDcd147077.28E-22132182No hitNo description
PfamPF001701.9E-14132182IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.31E-12132183No hitNo description
PROSITE patternPS000360135150IPR004827Basic-leucine zipper domain
PRINTSPR000416.6E-5145165IPR001630cAMP response element binding (CREB) protein
PRINTSPR000416.6E-5165182IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MEEVWKDISL STLHQDVPST PLLSFHHHHH RTFHTSNPTT TSSFGGITLE DFLADAPKEA  60
TRVPPPSSRP PASIDPSPDN SVRFFGYDLN TSACDCKISG SSFNDAHSEC TKKRSPEQQP  120
NRSIDGQDGA ERRKKRIIKN RESAARSRAR KQAYINELEL EVARLLNENH ALRRELEELR  180
MTVVASQNPT ASRRALQRTV TAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009383362.11e-151PREDICTED: protein FD-like isoform X2
TrEMBLM0S4U01e-151M0S4U0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P03490_0011e-150(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.16e-16bZIP family protein